| Edit |   |
| Antigenic Specificity | CREG2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CREG2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CREG2. This antibody reacts with human. The CREG2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CREG2(cellular repressor of E1A-stimulated genes 2) The peptide sequence was selected from the N terminal of CREG2. Peptide sequence VSSVSWAVTNEVDEELDSASTEEAMPALLEDSGSIWQQSFPASAHKEDAH. |
| Other Names | cellular repressor of E1A-stimulated genes 2 |
| Gene, Accession # | CREG2, Gene ID: 200407 |
| Catalog # | NBP1-70509-20ul |
| Price | |
| Order / More Info | CREG2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |