| Edit |   |
|---|
| Antigenic Specificity | CREG |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CREG Antibody from Novus Biologicals is a rabbit polyclonal antibody to CREG. This antibody reacts with mouse. The CREG Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is Creg1 - C-terminal region. Peptide sequence MMSGTVTKVNKTEEDYARDSLFVRHPEMKHWPSSHNWFFAKLKISRIWVL. |
|---|
| Other Names | cellular repressor of E1A-stimulated genes, cellular repressor of E1A-stimulated genes 1CREG, protein CREG1 |
|---|
| Gene, Accession # | CREG1, Gene ID: 8804, Accession: NP_035934 |
|---|
| Catalog # | NBP1-98341-20ul |
|---|
| Price | |
|---|
| Order / More Info | CREG Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|