| 产品详情 |
| Edit |   |
| Antigenic Specificity | RPIP8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RPIP8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPIP8. This antibody reacts with human, rat. The RPIP8 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, rat RPIP8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LKDLEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLGTLNGAEGASNSKL |
| Other Names | Rap2-interacting protein 8, RAP2IPRUN domain-containing protein 3A, RPIP-8, RPIP8RaP2 interacting protein 8, RUN domain containing 3A |
| Gene, Accession # | RUNDC3A, Gene ID: 10900, Accession: Q59EK9 |
| Catalog # | NBP1-80855 |
| Price | |
| Order / More Info | RPIP8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|