| Edit |   |
|---|
| Antigenic Specificity | RPIA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RPIA Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPIA. This antibody reacts with mouse. The RPIA Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is Rpia. Peptide sequence LICIPTSFQARQLILQYGLTLSDLDQHPEIDLAIDGADEVDAELNLIKGG. |
|---|
| Other Names | EC 5.3.1.6, Phosphoriboisomerase, ribose 5-phosphate epimerase, ribose 5-phosphate isomerase A, RPIribose-5-phosphate isomerase |
|---|
| Gene, Accession # | RPIA, Gene ID: 22934, Accession: NP_033101 |
|---|
| Catalog # | NBP1-79588 |
|---|
| Price | |
|---|
| Order / More Info | RPIA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|