| Edit |   |
|---|
| Antigenic Specificity | TGF beta induced factor 2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TGF beta induced factor 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TGF beta induced factor 2. This antibody reacts with human. The TGF beta induced factor 2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TGF beta induced factor 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLF |
|---|
| Other Names | homeobox protein TGIF2, TGF(beta)-induced transcription factor 2, TGF-beta-induced transcription factor 2,5'-TG-3'-interacting factor 2,5'-TG-3' interacting factor 2, TGFB-induced factor 2, TGFB-induced factor 2 (TALE family homeobox), TGFB-induced factor homeobox 2, transcription growth factor-beta-induced factor 2 |
|---|
| Gene, Accession # | TGIF2, Gene ID: 60436 |
|---|
| Catalog # | NBP2-56813 |
|---|
| Price | |
|---|
| Order / More Info | TGF beta induced factor 2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|