| Edit |   |
|---|
| Antigenic Specificity | RPL30 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RPL30 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPL30. This antibody reacts with human. The RPL30 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RPL30(ribosomal protein L30) The peptide sequence was selected from the middle region of RPL30. Peptide sequence MLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGE. |
|---|
| Other Names | 60S ribosomal protein L30, ribosomal protein L30 |
|---|
| Gene, Accession # | RPL30, Gene ID: 6156, Accession: P62888, SwissProt: P62888 |
|---|
| Catalog # | NBP1-53069 |
|---|
| Price | |
|---|
| Order / More Info | RPL30 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|