| Edit |   |
| Antigenic Specificity | RPL27 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RPL27 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPL27. This antibody reacts with mouse. The RPL27 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is Rpl27 - N-terminal region. Peptide sequence DDGTSDRPYSHALVAGIDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNYNH. |
| Other Names | ribosomal protein L27,60S ribosomal protein L27 |
| Gene, Accession # | RPL27, Gene ID: 6155, Accession: NP_035419 |
| Catalog # | NBP1-98580 |
| Price | |
| Order / More Info | RPL27 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |