| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MRP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MRP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MRP3. This antibody reacts with human. The MRP3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ABCC3(ATP-binding cassette, sub-family C (CFTR/MRP), member 3) The peptide sequence was selected from the middle region of ABCC3. Peptide sequence KVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADL. |
|---|
| Other Names | ABC31, ATP-binding cassette sub-family C member 3, ATP-binding cassette, sub-family C (CFTR/MRP), member 3, canalicular multispecific organic anion transporter 2, canicular multispecific organic anion transporter, cMOAT2, EC 3.6.3, EC 3.6.3.44, EC 6.3.2.4, MLP2DKFZp686E22157, MRP3MOAT-DEST90757, multidrug resistance associated protein, Multidrug resistance-associated protein 3, Multi-specific organic anion transporter D |
|---|
| Gene, Accession # | ABCC3, Gene ID: 8714, Accession: O15438, SwissProt: O15438 |
|---|
| Catalog # | NBP1-59806 |
|---|
| Price | |
|---|
| Order / More Info | MRP3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|