| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MRP1 |
|---|
| Clone | IU5C1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | IgG1 |
|---|
| Format | unpurified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. This MRP1 antibody is useful for Immunocytochemistry/Immunofluorescence and Western blot analysis on transfected lysate, where a band is seen at 172 kDa. The use of this antibody in ICC/IF was reported in literature. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MRP1 Antibody (IU5C1) from Novus Biologicals is a mouse monoclonal antibody to MRP1. This antibody reacts with human, mouse. The MRP1 Antibody (IU5C1) has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot# P33527] |
|---|
| Other Names | ABC29, ABCC, ATP-binding cassette sub-family C member 1, ATP-binding cassette, sub-family C (CFTR/MRP), member 1, EC 3.6.3, EC 3.6.3.44, GS-X, Leukotriene C(4) transporter, LTC4 transporter, MRP1DKFZp781G125, MRPDKFZp686N04233, multidrug resistance associated protein 1, multidrug resistance protein, multidrug resistance-associated protein 1, multiple drug resistance protein 1, multiple drug resistance-associated protein |
|---|
| Gene, Accession # | ABCC1, Gene ID: 4363, Accession: P33527, SwissProt: P33527 |
|---|
| Catalog # | NB110-57131 |
|---|
| Price | |
|---|
| Order / More Info | MRP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 16914551 |
|---|
| 产品资料 |
|
|