| Edit |   |
|---|
| Antigenic Specificity | MROH2B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MROH2B Antibody from Novus Biologicals is a rabbit polyclonal antibody to MROH2B. This antibody reacts with human. The MROH2B Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MROH2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DKEHIQFLYERSMDALGKLLKTMMWDNVNAEDCQEMFNLLQMWLVSQKEWERERAFQITAKVLTNDIEAPENFKIGSLLGLLAPHSCDTLPTI |
|---|
| Other Names | HEAT Repeat Family Member 7B2, HEAT Repeat Family Member B2, HEAT Repeat-Containing Protein 7B2, HEATR7B2, Maestro Heat-Like Repeat Family Member 2B, Maestro Heat-Like Repeat-Containing Protein Family Member 2B |
|---|
| Gene, Accession # | MROH2B, Gene ID: 133558, Accession: Q7Z745 |
|---|
| Catalog # | NBP2-32466 |
|---|
| Price | |
|---|
| Order / More Info | MROH2B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|