| 产品详情 |
| Edit |   |
| Antigenic Specificity | Sodium Potassium ATPase Alpha 3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Sodium Potassium ATPase Alpha 3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Sodium Potassium ATPase Alpha 3. This antibody reacts with human. The Sodium Potassium ATPase Alpha 3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Sodium Potassium ATPase Alpha 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE |
| Other Names | alpha 3 polypeptide, ATPase, Na+/K+ transporting, alpha 3 polypeptide, dystonia 12, DYT12, EC 3.6.3, MGC13276, RDP, Sodium pump subunit alpha-3, sodium/potassium-transporting ATPase alpha-3 chain, sodium/potassium-transporting ATPase subunit alpha-3 |
| Gene, Accession # | ATP1A3, Gene ID: 478, Accession: P13637, SwissProt: P13637 |
| Catalog # | NBP2-37955 |
| Price | |
| Order / More Info | Sodium Potassium ATPase Alpha 3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|