| Edit |   |
|---|
| Antigenic Specificity | KRTAP3-3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KRTAP3-3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KRTAP3-3. This antibody reacts with mouse. The KRTAP3-3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is Krtap3-3 - N-terminal region. Peptide sequence SVPTGPATTICSSDKSCRCGVCLPSTCPHTIWQLEPTCCDNCPPPCHIPQ. |
|---|
| Other Names | High sulfur keratin-associated protein 3.3, KAP3.3MGC95374, keratin associated protein 3-3, Keratin-associated protein 3.3, keratin-associated protein 3-3, KRTAP3.3 |
|---|
| Gene, Accession # | KRTAP3-3, Gene ID: 85293, Accession: NP_079800 |
|---|
| Catalog # | NBP1-98505-20ul |
|---|
| Price | |
|---|
| Order / More Info | KRTAP3-3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|