| Edit |   |
| Antigenic Specificity | KRTAP24-1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KRTAP24-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KRTAP24-1. This antibody reacts with human. The KRTAP24-1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human KRTAP24-1. Peptide sequence LVRNYHYSSYRPTSCRPLSYLSRSFRSLSYIPSTFPPLRYLCSGSRPLKC. |
| Other Names | KAP24.1, keratin associated protein 24-1, keratin-associated protein 24-1 |
| Gene, Accession # | KRTAP24-1, Gene ID: 643803, Accession: NP_001078924, SwissProt: NP_001078924 |
| Catalog # | NBP1-91600-20ul |
| Price | |
| Order / More Info | KRTAP24-1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |