| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AMBRA1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AMBRA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AMBRA1. This antibody reacts with human. The AMBRA1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human AMBRA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: WCVTFHPTISGLIASGCLDGEVRIWDLHGGSESWFTDSNNAIASLAFHPTAQLLLIATANEIHFWDWSRREPFAVVKTASEMERVRL |
|---|
| Other Names | activating molecule in BECN1-regulated autophagy protein 1, autophagy/beclin-1 regulator 1, DCAF3, DDB1 and CUL4 associated factor 3, FLJ20294, KIAA1736activating molecule in beclin-1-regulated autophagy, MGC33725, WD repeat domain 94, WDR94 |
|---|
| Gene, Accession # | AMBRA1, Gene ID: 55626 |
|---|
| Catalog # | NBP2-32640 |
|---|
| Price | |
|---|
| Order / More Info | AMBRA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|