| Edit |   |
|---|
| Antigenic Specificity | RAP1B, Member of RAS Oncogene Family (RAP1B) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat, Drosophila |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RAP1B and RAP1A belong to a superfamily of RAS-like small GTP-binding proteins involved in cell signaling. |
|---|
| Immunogen | RAP1 B antibody was raised using the N terminal of RAP1 corresponding to a region with amino acids MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQ |
|---|
| Other Names | K-REV|RAL1B|k-rev|ral1b|2810443E11Rik |
|---|
| Gene, Accession # | Gene ID: 5908,215449,171337 |
|---|
| Catalog # | ABIN631250 |
|---|
| Price | |
|---|
| Order / More Info | RAP1B, Member of RAS Oncogene Family (RAP1B) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|