| Edit |   |
|---|
| Antigenic Specificity | Protocadherin gamma Subfamily A, 4 (PCDHGA4) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | PCDHGA4 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHGA4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain. |
|---|
| Immunogen | PCDHGA4 antibody was raised using the N terminal of PCDHGA4 corresponding to a region with amino acids GDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRENVPVGTRLLTVKAT |
|---|
| Other Names | PCDH-GAMMA-A4|Pcdhga3|PCDHGA4 |
|---|
| Gene, Accession # | Gene ID: 56111,93712,252894 |
|---|
| Catalog # | ABIN634712 |
|---|
| Price | |
|---|
| Order / More Info | Protocadherin gamma Subfamily A, 4 (PCDHGA4) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|