| Edit |   |
| Antigenic Specificity | COX15 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 96%, rat 96%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human COX15 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LTESGLSMVDWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFI |
| Other Names | cytochrome c oxidase assembly homolog 15 (yeast) |
| Gene, Accession # | Gene ID: 1355, UniProt: Q7KZN9, ENSG00000014919 |
| Catalog # | HPA037727 |
| Price | |
| Order / More Info | COX15 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |