| Edit |   |
|---|
| Antigenic Specificity | Interferon-Induced Protein with Tetratricopeptide Repeats 5 (IFIT5) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | IFIT5 belongs to the IFIT family. It contains 8 TPR repeats. The exact function of IFIT5 remains unknown. |
|---|
| Immunogen | IFIT5 antibody was raised using the middle region of IFIT5 corresponding to a region with amino acids ITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAE |
|---|
| Other Names | ri58|DKFZp469M2320|P58|RI58 |
|---|
| Gene, Accession # | Gene ID: 24138 |
|---|
| Catalog # | ABIN634393 |
|---|
| Price | |
|---|
| Order / More Info | Interferon-Induced Protein with Tetratricopeptide Repeats 5 (IFIT5) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|