| Edit |   |
| Antigenic Specificity | HTR2A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 95%, rat 97%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human HTR2A polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: TIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIHREPGSYTGRRTMQSISNEQ |
| Other Names | 5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled, 5-HT2A, HTR2 |
| Gene, Accession # | Gene ID: 3356, UniProt: P28223, ENSG00000102468 |
| Catalog # | HPA014011 |
| Price | |
| Order / More Info | HTR2A Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |