| Edit |   |
|---|
| Antigenic Specificity | Exportin-5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-Exportin-5 Picoband Antibody. Reactivity: Human, Mouse, Rat No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Exportin-5 (2-43aa AMDQVNALCEQLVKAVTVMMDPNSTQRYRLEALKFCEEFKEK), different from the related mouse sequence by four amino acids.Subcellular Localization: Nucleus. Cytoplasm. Shuttles between the nucleus and the cytoplasm.Tiss |
|---|
| Other Names | exportin-5; Exportin-5; exportin-5; exportin 5; Ran-binding protein 21, XPO5; XPO5; exp5; KIAA1291; RANBP21; Exp5 |
|---|
| Gene, Accession # | XPO5, Gene ID: 57510, NCBI: NP_065801.1, UniProt: Q9HAV4 |
|---|
| Catalog # | MBS1750797 |
|---|
| Price | |
|---|
| Order / More Info | Exportin-5 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|