| Edit |   |
|---|
| Antigenic Specificity | DCST1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | DCST1 antibody. Specificity: DCST1 antibody was raised against the C terminal of DCST1 |
|---|
| Immunogen | DCST1 antibody was raised using the C terminal of DCST1 corresponding to a region with amino acids SYVCRTLDCEAVYCWSCWDDMRQRCPVCTPREELSSSAFSDSNDDTAYAG |
|---|
| Other Names | DCST1 protein; DC-STAMP domain-containing protein 1; DC-STAMP domain-containing protein 1; DC-STAMP domain containing 1, DCST1; DCST1 |
|---|
| Gene, Accession # | DCST1, Gene ID: 149095, NCBI: AAH64844.1 |
|---|
| Catalog # | MBS5302656 |
|---|
| Price | |
|---|
| Order / More Info | DCST1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|