| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NIRF |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-NIRF Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human NIRF (15-54aa TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN), identical to the related mouse and rat sequences.Ig Type: Rabbit IgG |
|---|
| Other Names | E3 ubiquitin-protein ligase UHRF2; E3 ubiquitin-protein ligase UHRF2; E3 ubiquitin-protein ligase UHRF2; ubiquitin like with PHD and ring finger domains 2; Np95/ICBP90-like RING finger protein; Np95-like RING finger protein; Nuclear protein 97; Nuclear zinc finger protein Np97; RING finger protein 107; Ubiquitin-like PHD and RING finger domain-containing protein 2; Ubiquitin-like-containing PHD and RING finger domains protein 2, UHRF2; UHRF2; NIRF; URF2; RNF107; TDRD23; NIRF; RNF107; Np95-like R |
|---|
| Gene, Accession # | NIRF, Gene ID: 115426, NCBI: NP_690856.1, UniProt: Q96PU4 |
|---|
| Catalog # | MBS177883 |
|---|
| Price | |
|---|
| Order / More Info | NIRF Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: UHRF2 ubiquitin-like, containing PHD and RING finger domains, 2. 2. Mori T, Li Y, Hata H, Ono K, Kochi H (Aug 2002). NIRF, a novel RING finger protein, is involved in cell-cycle regulation. Biochem Biophys Res Commun 296 (3): 530-6. |
|---|
| 产品资料 |
|
|