| Edit |   |
|---|
| Antigenic Specificity | SDR-O |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SDR-O antibody. Specificity: SDR-O antibody was raised against the middle region of SDR-O |
|---|
| Immunogen | SDR-O antibody was raised using the middle region of SDR-O corresponding to a region with amino acids SMEHAIVSRSPRIRYNPGLDAKLLYIPLAKLPTPVTDFILSRYLPRPADS |
|---|
| Other Names | short-chain dehydrogenase/reductase family 9C member 7; Short-chain dehydrogenase/reductase family 9C member 7; short-chain dehydrogenase/reductase family 9C member 7; short chain dehydrogenase/reductase family 9C, member 7; Orphan short-chain dehydrogenase/reductase; SDR-O; RDH-S, SDR9C7; SDR9C7; RDHS; SDRO; SDR-O; RDHS; SDRO; SDR-O |
|---|
| Gene, Accession # | SDR-O, Gene ID: 121214, NCBI: NP_683695.1 |
|---|
| Catalog # | MBS5303026 |
|---|
| Price | |
|---|
| Order / More Info | SDR-O Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|