| Edit |   |
|---|
| Antigenic Specificity | TINAG |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | TINAG antibody. Specificity: TINAG antibody was raised against the middle region of TINAG |
|---|
| Immunogen | TINAG antibody was raised using the middle region of TINAG corresponding to a region with amino acids VAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG |
|---|
| Other Names | TINAG protein; Tubulointerstitial nephritis antigen; tubulointerstitial nephritis antigen; tubulointerstitial nephritis antigen, TINAG; TINAG; TIN-AG; TIN-Ag |
|---|
| Gene, Accession # | TINAG, Gene ID: 27283, NCBI: AAH56235.1 |
|---|
| Catalog # | MBS839405 |
|---|
| Price | |
|---|
| Order / More Info | TINAG Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|