| Edit |   |
|---|
| Antigenic Specificity | TIMP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
|---|
| Applications | ELISA (EIA), Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-TIMP3 Picoband Antibody. Reactivity: Human, Mouse, Rat No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human TIMP3 (107-141aa RVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHL), different from the related mouse and rat sequences by two amino acids.Subcellular Localization: Secreted, extracellular space, extracellular matrix. |
|---|
| Other Names | metalloproteinase inhibitor 3; Metalloproteinase inhibitor 3; metalloproteinase inhibitor 3; TIMP metallopeptidase inhibitor 3; Protein MIG-5; Tissue inhibitor of metalloproteinases 3; TIMP-3, TIMP3; TIMP3; SFD; K222; K222TA2; HSMRK222; TIMP-3 |
|---|
| Gene, Accession # | TIMP3, Gene ID: 7078, NCBI: NP_000353.1, UniProt: P35625 |
|---|
| Catalog # | MBS1750417 |
|---|
| Price | |
|---|
| Order / More Info | TIMP3 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|