| Edit |   |
|---|
| Antigenic Specificity | HS3ST3B1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | HS3ST3B1 antibody |
|---|
| Immunogen | HS3ST3B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPALATAPDGTPPR |
|---|
| Other Names | heparan sulfate glucosamine 3-O-sulfotransferase 3B1; Heparan sulfate glucosamine 3-O-sulfotransferase 3B1; heparan sulfate glucosamine 3-O-sulfotransferase 3B1; heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1; Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3B1; 3-OST-3B; Heparan sulfate 3-O-sulfotransferase 3B1; h3-OST-3B, HS3ST3B1; HS3ST3B1; 3OST3B1; 3-OST-3B; h3-OST-3B; 3OST3B1; HS3ST3B; 3-OST-3B; Heparan sulfate 3-O-sulfotransferase 3B1; h3-OST-3B |
|---|
| Gene, Accession # | HS3ST3B1, Gene ID: 9953, NCBI: NP_006032.1 |
|---|
| Catalog # | MBS5303391 |
|---|
| Price | |
|---|
| Order / More Info | HS3ST3B1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|