| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Villin |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-Villin Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Villin (770-799 aa EQLVNKPVEELPEGVDPSRKEEHLSIEDFT), different from the related mouse sequence by three amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | villin-1; Villin-1; villin-1; villin 1, VIL1; VIL1; VIL; D2S1471; VIL |
|---|
| Gene, Accession # | Gene ID: 7429, NCBI: NP_009058.2, UniProt: P09327 |
|---|
| Catalog # | MBS178308 |
|---|
| Price | |
|---|
| Order / More Info | Villin Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Friederich, E; Vancompernolle, K; Louvard, D; Vandekerckhove, J (1999). Villin function in the organization of the actin cytoskeleton. Correlation of in vivo effects to its biochemical activities in vitro. The Journal of Biological Chemistry274 (38): 26751-60. 2. Meng, J; Vardar, D; Wang, Y; Guo, HC; Head, JF; McKnight, CJ (2005). High-resolution crystal structures of villin headpiece and mutants with reduced F-actin binding activity. Biochemistry 44 (36): 11963-73. |
|---|
| 产品资料 |
|
|