Edit |   |
Antigenic Specificity | Solute Carrier Family 23 (Nucleobase Transporters), Member 2 (SLC23A2) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two required transporters and the encoded protein accounts for tissue-specific uptake of vitamin C. Previously, this gene had an official symbol of SLC23A1. |
Immunogen | SLC23 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIYKSK |
Other Names | NBTL1|SLC23A1|SVCT2|YSPL2|SLC23A2|AI844736|Slc23a1|YSPL3|mKIAA0238 |
Gene, Accession # | Gene ID: 9962,54338,50622 |
Catalog # | ABIN634854 |
Price | |
Order / More Info | Solute Carrier Family 23 (Nucleobase Transporters), Member 2 (SLC23A2) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |