Edit |   |
Antigenic Specificity | Solute Carrier Family 6 (Neutral Amino Acid Transporter), Member 15 (SLC6A15) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | SLC6A15 shows structural characteristics of an Na(+) and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites. |
Immunogen | SLC6 A15 antibody was raised using a synthetic peptide corresponding to a region with amino acids YISPLMLLSLLIASVVNMGLSPPGYNAWIEDKASEEFLSYPTWGLVVCVS |
Other Names | B0AT2|AA536730|AI326450|AI326451|v7-3|NTT73|SBAT1|V7-3|hv7-3|Ntt73 |
Gene, Accession # | Gene ID: 55117 |
Catalog # | ABIN635136 |
Price | |
Order / More Info | Solute Carrier Family 6 (Neutral Amino Acid Transporter), Member 15 (SLC6A15) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |