Edit |   |
Antigenic Specificity | Solute Carrier Family 6 (Neurotransmitter Transporter, Glycine), Member 5 (SLC6A5) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | This gene encodes a sodium- and chloride-dependent glycine neurotransmitter transporter. This integral membrane glycoprotein is responsible for the clearance of extracellular glycine during glycine-mediated neurotransmission. |
Immunogen | SLC6 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPE |
Other Names | SLC6A5|Glyt2|prestin|GLYT-2|GLYT2|HKPX3|NET1 |
Gene, Accession # | Gene ID: 9152 |
Catalog # | ABIN635139 |
Price | |
Order / More Info | Solute Carrier Family 6 (Neurotransmitter Transporter, Glycine), Member 5 (SLC6A5) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |