| Edit |   |
|---|
| Antigenic Specificity | Solute Carrier Family 6 (Neurotransmitter Transporter, Creatine), Member 8 (SLC6A8) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SLC6A8 is required for the uptake of creatine in muscles and brain. |
|---|
| Immunogen | SLC6 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFSILGFMAAEQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFF |
|---|
| Other Names | SLC6A8|chot1|crtr|creaT|CRT|RO|SSA|cC1qR|Calregulin|AA589632|CRTR|CT1|Creat|CCDS1|CHOT1|CHT1 |
|---|
| Gene, Accession # | Gene ID: 6535 |
|---|
| Catalog # | ABIN635581 |
|---|
| Price | |
|---|
| Order / More Info | Solute Carrier Family 6 (Neurotransmitter Transporter, Creatine), Member 8 (SLC6A8) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|