| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TSG6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-TSG6 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human TSG6 (46-91aa KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGR), different from the related mouse sequence by two amino acids. |
|---|
| Other Names | tumor necrosis factor-inducible gene 6 protein; Tumor necrosis factor-inducible gene 6 protein; tumor necrosis factor-inducible gene 6 protein; TNF alpha induced protein 6; Hyaluronate-binding protein; TNF-stimulated gene 6 protein; TSG-6; Tumor necrosis factor alpha-induced protein 6; TNF alpha-induced protein 6, TNFAIP6; TNFAIP6; TSG6; TSG-6; TSG6; TSG-6; TNF alpha-induced protein 6 |
|---|
| Gene, Accession # | TNFAIP6, Gene ID: 7130, NCBI: NP_009046.2, UniProt: P98066 |
|---|
| Catalog # | MBS178683 |
|---|
| Price | |
|---|
| Order / More Info | TSG6 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: TNFAIP6 tumor necrosis factor, alpha-induced protein 6. 2. Lee TH, Klampfer L, Shows TB, Vilcek J (March 1993). Transcriptional regulation of TSG6, a tumor necrosis factor- and interleukin-1-inducible primary response gene coding for a secreted hyaluronan-binding protein. J. Biol. Chem. 268 (9): 6154-60. 3. Milner CM, Day AJ (2004). TSG-6: a multifunctional protein associated with inflammation.. J. Cell. Sci. 116 (Pt 10): 1863-73. |
|---|
| 产品资料 |
|
|