| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TSG101 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-TSG101 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human TSG101 (361-390aa KHVRLLSRKQFQLRALMQKARKTAGLSDLY), identical to the related mouse and rat sequences.Ig Type: Rabbit IgG |
|---|
| Other Names | tumor susceptibility gene 101 protein; Tumor susceptibility gene 101 protein; tumor susceptibility gene 101 protein; tumor susceptibility 101; ESCRT-I complex subunit TSG101, TSG101; TSG101; TSG10; VPS23 |
|---|
| Gene, Accession # | TSG101, Gene ID: 7251, NCBI: NP_006283.1, UniProt: Q99816 |
|---|
| Catalog # | MBS178116 |
|---|
| Price | |
|---|
| Order / More Info | TSG101 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: TSG101 tumor susceptibility gene 101. 2. Lu Q, Hope LW, Brasch M, Reinhard C, Cohen SN (June 2003). TSG101 interaction with HRS mediates endosomal trafficking and receptor down-regulation.Proc. Natl. Acad. Sci. U.S.A. 100 (13): 7626-31. 3. Sun Z, Pan J, Hope WX, Cohen SN, Balk SP (August 1999). Tumor susceptibility gene 101 protein represses androgen receptor transactivation and interacts with p300. Cancer 86 (4): 689-96. |
|---|
| 产品资料 |
|
|