| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | STXBP2 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-STXBP2 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human STXBP2 (184-215aa QEYPAIRYRKGPEDTAQLAHAVLAKLNAFKAD), different from the related mouse and rat sequences by one amino acid.Ig Type: Rabbit IgG |
|---|
| Other Names | syntaxin-binding protein 2 isoform b; Syntaxin-binding protein 2; syntaxin-binding protein 2; syntaxin binding protein 2; Protein unc-18 homolog 2; Unc18-2; Protein unc-18 homolog B; Unc-18B, STXBP2; STXBP2; FHL5; UNC18B; Hunc18b; UNC18-2; pp10122; MUNC18-2; UNC18B; Unc18-2; Unc-18B |
|---|
| Gene, Accession # | STXBP2, Gene ID: 6813, NCBI: NP_001120868.1, UniProt: Q15833 |
|---|
| Catalog # | MBS177970 |
|---|
| Price | |
|---|
| Order / More Info | STXBP2 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: STXBP2 syntaxin binding protein 2. 2. Cetica, V., Santoro, A., Gilmour, K. C., Sieni, E., Beutel, K., Pende, D., Marcenaro, S., Koch, F., Grieve, S., Wheeler, R., Zhao, F., zur Stadt, U., Griffiths, G. M., Arico, M. STXBP2 mutations in children with familial haemophagocytic lymphohistiocytosis type 5. J. Med. Genet. 47: 595-600, 2010. 3. Ziegler, S.F., Mortrud, M. T., Swartz, A. R., Baker, E., Sutherland, G. R., Burmeister, M., Mulligan, J. T. Molecular characterization of a no |
|---|
| 产品资料 |
|
|