| Edit |   |
| Antigenic Specificity | THOC3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 100%, rat 100%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | ICC-IF, WB. Genetic validation in WB by siRNA knockdown. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human THOC3 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PSNPDLFVTASGDKTIRIWDVRTTKCIATVNTKGENINICWSPDGQTIAVGNKDDVVT |
| Other Names | THO complex 3, MGC5469, TEX1 |
| Gene, Accession # | Gene ID: 84321, UniProt: Q96J01, ENSG00000051596 |
| Catalog # | HPA045071 |
| Price | |
| Order / More Info | THOC3 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |