| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KCNA3 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-KCNA3 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human KCNA3 (513-544aa EELRKARSNSTLSKSEYMVIEEGGMNHSAFPQ), identical to the related mouse and rat sequences.Ig Type: Rabbit IgG |
|---|
| Other Names | potassium voltage-gated channel subfamily A member 3; Potassium voltage-gated channel subfamily A member 3; potassium voltage-gated channel subfamily A member 3; potassium voltage-gated channel subfamily A member 3; HGK5; HLK3; HPCN3; Voltage-gated K(+) channel HuKIII; Voltage-gated potassium channel subunit Kv1.3, KCNA3; KCNA3; MK3; HGK5; HLK3; PCN3; HPCN3; KV1.3; HUKIII; HGK5 |
|---|
| Gene, Accession # | KCNA3, Gene ID: 3738, NCBI: NP_002223.3, UniProt: P22001 |
|---|
| Catalog # | MBS177763 |
|---|
| Price | |
|---|
| Order / More Info | KCNA3 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Szabo I, Bock J, Grassme H, Soddemann M, Wilker B, Lang F, Zoratti M, Gulbins E (September 2008). Mitochondrial potassium channel Kv1.3 mediates Bax-induced apoptosis in lymphocytes. Proc. Natl. Acad. Sci. U.S.A. 105 (39): 14861-6. 2. Storey NM, Gomez-Angelats M, Bortner CD, Armstrong DL, Cidlowski JA (August 2003). Stimulation of Kv1.3 potassium channels by death receptors during apoptosis in Jurkat T lymphocytes. J. Biol. Chem. 278 (35): 33319-26. |
|---|
| 产品资料 |
|
|