| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KChIP2 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-KChIP2 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human KChIP2 (78-112aa DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYR), different from the related mouse and rat sequences by one amino acid.Ig Type: Rabbit IgG |
|---|
| Other Names | Kv channel-interacting protein 2 isoform 1; Kv channel-interacting protein 2; Kv channel-interacting protein 2; potassium voltage-gated channel interacting protein 2; A-type potassium channel modulatory protein 2; Cardiac voltage-gated potassium channel modulatory subunit; Potassium channel-interacting protein 2, KCNIP2; KCNIP2; KCHIP2; KCHIP2; KChIP2 |
|---|
| Gene, Accession # | KChIP2, Gene ID: 30819, NCBI: NP_055406.2, UniProt: Q9NS61 |
|---|
| Catalog # | MBS177876 |
|---|
| Price | |
|---|
| Order / More Info | KChIP2 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. An WF, Bowlby MR, Betty M, Cao J, Ling HP, Mendoza G, Hinson JW, Mattsson KI, Strassle BW, Trimmer JS, Rhodes KJ (Feb 2000). Modulation of A-type potassium channels by a family of calcium sensors. Nature 403(6769): 553-6. 2. Burgoyne RD (2007). Neuronal calcium sensor proteins: generating diversity in neuronal Ca2 signalling. Nat. Rev. Neurosci. 8 (3): 182-93. |
|---|
| 产品资料 |
|
|