| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ABR |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-ABR Antibody. Reactivity: Human, Mouse, Rat No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human ABR (370-407aa HPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERL), different from the related mouse sequence by one amino acid. |
|---|
| Other Names | active breakpoint cluster region-related protein isoform b; Active breakpoint cluster region-related protein; active breakpoint cluster region-related protein; active BCR-related, ABR; ABR; MDB |
|---|
| Gene, Accession # | ABR, Gene ID: 29, NCBI: NP_001083.2, UniProt: Q12979 |
|---|
| Catalog # | MBS178472 |
|---|
| Price | |
|---|
| Order / More Info | ABR Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Heisterkamp, N., Kaartinen, V., van Soest, S., Bokoch, G. M., Groffen, J. Human ABR encodes a protein with GAP-rac activity and homology to the DBL nucleotide exchange factor domain. J. Biol. Chem. 268: 16903-16906, 1993. 2. Heisterkamp, N., Morris, C., Groffen, J. ABR, an active BCR-related gene. Nucleic Acids Res. 17: 8821-8831, 1989. 3. McDonald, J. D., Daneshvar, L., Willert, J. R., Matsumura, K., Waldman, F., Cogen, P. H. Physical mapping of chromosome 17p13.3 in the region of a p |
|---|
| 产品资料 |
|
|