| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ABP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-ABP1 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ABP1 (144-180aa STAEYALLYHTLQEATKPLHQFFLNTTGFSFQDCHDR), different from the related mouse sequence by ten amino acids, and from the related rat sequence by eight amino acids. |
|---|
| Other Names | amiloride-sensitive amine oxidase; Amiloride-sensitive amine oxidase copper-containing; amiloride-sensitive amine oxidase copper-containing; amine oxidase, copper containing 1; Amiloride-binding protein 1; Amine oxidase copper domain-containing protein 1; Histaminase; Kidney amine oxidase; KAO, AOC1; AOC1; ABP; DAO; KAO; ABP1; DAO1; ABP1; DAO1; DAO; Diamine oxidase; KAO |
|---|
| Gene, Accession # | AOC1, Gene ID: 26, NCBI: NP_001082.2, UniProt: P19801 |
|---|
| Catalog # | MBS178796 |
|---|
| Price | |
|---|
| Order / More Info | ABP1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Human kidney amiloride-binding protein: cDNA structure and functional expression.Barbry P., Champe M., Chassande O., Munemitsu S., Champigny G., Lingueglia E., Maes P., Frelin C., Tartar A., Ullrich A., Lazdunski M.Proc. Natl. Acad. Sci. U.S.A. 87: 7347-7351(1990). 2. Structure and inhibition of human diamine oxidase.McGrath A.P., Hilmer K.M., Collyer C.A., Shepard E.M., Elmore B.O., Brown D.E., Dooley D.M., Guss J.M.Biochemistry 48: 9810-9822(2009). |
|---|
| 产品资料 |
|
|