| Edit |   |
|---|
| Antigenic Specificity | Influenza Virus Ns1A Binding |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, dog |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Influenza Virus Ns1A Binding Protein antibody. Specificity: Influenza Virus Ns1A Binding Protein antibody was raised against the N terminal of IVNS1ABP |
|---|
| Immunogen | Influenza Virus Ns1A Binding Protein antibody was raised using the N terminal of IVNS1ABP corresponding to a region with amino acids RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK |
|---|
| Other Names | Influenza Virus Ns1A Binding Protein; Influenza Virus Ns1A Binding Protein; Swine Flu; Influenza A nuclear; Flu A; Influenza Ns1A Binding Protein; H1N1; Influenza ABP; Flu A H1N1; IVNS1ABP, |
|---|
| Gene, Accession # | n/a |
|---|
| Catalog # | MBS5301920 |
|---|
| Price | |
|---|
| Order / More Info | Influenza Virus Ns1A Binding Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|