| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | p95 NBS1 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-p95 NBS1 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human p95 NBS1 (714-745aa RKNTELEEWLRQEMEVQNQHAKEESLADDLFR), different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | nibrin isoform 2; Nibrin; nibrin; nibrin; Cell cycle regulatory protein p95; Nijmegen breakage syndrome protein 1, NBN; NBN; ATV; NBS; P95; NBS1; AT-V1; AT-V2; NBS; NBS1; P95 |
|---|
| Gene, Accession # | p95 NBS1, Gene ID: 4683, NCBI: NP_001019859.1, UniProt: O60934 |
|---|
| Catalog # | MBS177831 |
|---|
| Price | |
|---|
| Order / More Info | p95 NBS1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Atlas of Genetics and Cytogenetics in Oncology and Haematology - NBS1. 2. Carney JP, Maser RS, Olivares H, Davis EM, Le Beau M, Yates JR, Hays L, Morgan WF, Petrini JH (May 1998). The hMre11/hRad50 protein complex and Nijmegen breakage syndrome: linkage of double-strand break repair to the cellular DNA damage response. Cell 93 (3): 477-86. 3. Varon R, Vissinga C, Platzer M, Cerosaletti KM, Chrzanowska KH, Saar K, Beckmann G, Seemanova E, Cooper PR, Nowak NJ, Stumm M, Weemaes CM, Gatti RA, |
|---|
| 产品资料 |
|
|