| Edit |   |
|---|
| Antigenic Specificity | CK1 alpha 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CK1 alpha 1 antibody. Specificity: CK1 alpha 1 antibody was raised against the C terminal of CSNK1A1 |
|---|
| Immunogen | CK1 alpha 1 antibody was raised using the C terminal of CSNK1A1 corresponding to a region with amino acids HQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF |
|---|
| Other Names | CK1 alpha 1; CK1 alpha 1; CK1; CK-1; PRO2975; HLCDGP1; CK 1; Casein Kinase 1 Alpha 1; CSNK1A1, |
|---|
| Gene, Accession # | CK1 alpha 1 |
|---|
| Catalog # | MBS5300328 |
|---|
| Price | |
|---|
| Order / More Info | CK1 alpha 1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|