| Edit |   |
|---|
| Antigenic Specificity | PERLD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | PERLD1 antibody. Specificity: PERLD1 antibody was raised against the N terminal of PERLD1 |
|---|
| Immunogen | PERLD1 antibody was raised using the N terminal of PERLD1 corresponding to a region with amino acids ECMWVTVGLYLQEGHKVPQFHGKWPFSRFLFFQEPASAVASFLNGLASLV |
|---|
| Other Names | PERLD1; PERLD1; PERLD-1; PERLD 1; CAB2; PP1498; PERLD1; AGLA546; MGC9753; Per1-Like Domain Containing 1, |
|---|
| Gene, Accession # | PERLD1 |
|---|
| Catalog # | MBS839400 |
|---|
| Price | |
|---|
| Order / More Info | PERLD1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|