| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PML |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-PML Protein Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of mouse PML Protein (140-177aa LADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDN), different from the related human sequence by six amino acids. |
|---|
| Other Names | protein PML isoform 3; Protein PML; protein PML; promyelocytic leukemia, Pml; Pml; Trim19; AI661194; 1200009E24Rik |
|---|
| Gene, Accession # | PML, Gene ID: 18854, NCBI: NP_001298017.1, UniProt: Q60953 |
|---|
| Catalog # | MBS178841 |
|---|
| Price | |
|---|
| Order / More Info | PML Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Dyck, J. A., Maul, G. G., Miller, W. H., Jr., Chen, J. D., Kakizuka, A., Evans, R. M. A novel macromolecular structure is a target of the promyelocyte-retinoic acid receptor oncoprotein. Cell 76: 333-343, 1994. 2. Giorgi, C., Ito, K., Lin, H.-K., Santangelo, C., Wieckowski, M. R., Lebiedzinska, M., Bononi, A., Bonora, M., Duszynski, J., Bernardi, R., Rizzuto, R., Tacchetti, C., Pinton, P., Pandolfi, P. P. PML regulates apoptosis at endoplasmic reticulum by modulating calcium release. Scien |
|---|
| 产品资料 |
|
|