Edit |   |
Antigenic Specificity | SLC15A4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | SLC15A4 antibody. Specificity: SLC15A4 antibody was raised against the middle region of SLC15A4 |
Immunogen | SLC15A4 antibody was raised using the middle region of SLC15A4 corresponding to a region with amino acids GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH |
Other Names | solute carrier family 15 member 4; Solute carrier family 15 member 4; solute carrier family 15 member 4; solute carrier family 15 (oligopeptide transporter), member 4; Peptide transporter 4; Peptide/histidine transporter 1; hPHT1, SLC15A4; SLC15A4; PHT1; PTR4; FP12591; PHT1; PTR4; hPHT1 |
Gene, Accession # | SLC15A4, Gene ID: 121260, NCBI: NP_663623.1 |
Catalog # | MBS5300967 |
Price | |
Order / More Info | SLC15A4 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |