| Edit |   |
| Antigenic Specificity | Pannexin 2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat, dog, zebrafish |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 0.1 mg |
| Concentration | 1 mg/ml |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Pannexin 2 antibody. Specificity: Pannexin 2 antibody was raised against the N terminal of PANX2 |
| Immunogen | Pannexin 2 antibody was raised using the N terminal of PANX2 corresponding to a region with amino acids GTVLVPILLVTLVFTKNFAEEPIYCYTPHNFTRDQALYARGYCWTELRDA |
| Other Names | pannexin 2; pannexin 2, LOC100533356 |
| Gene, Accession # | Gene ID: 100533356, NCBI: NP_001191579.1 |
| Catalog # | MBS5300690 |
| Price | |
| Order / More Info | Pannexin 2 Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |