Edit |   |
Antigenic Specificity | Pannexin 2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat, dog, zebrafish |
Isotype | n/a |
Format | Protein A purified |
Size | 0.1 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB), Immunohistochemistry (IHC) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Pannexin 2 antibody. Specificity: Pannexin 2 antibody was raised against the N terminal of PANX2 |
Immunogen | Pannexin 2 antibody was raised using the N terminal of PANX2 corresponding to a region with amino acids GTVLVPILLVTLVFTKNFAEEPIYCYTPHNFTRDQALYARGYCWTELRDA |
Other Names | pannexin 2; pannexin 2, LOC100533356 |
Gene, Accession # | Gene ID: 100533356, NCBI: NP_001191579.1 |
Catalog # | MBS5300690 |
Price | |
Order / More Info | Pannexin 2 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |