Edit |   |
Antigenic Specificity | PANK4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | PANK4 antibody. Specificity: PANK4 antibody was raised against the N terminal of PANK4 |
Immunogen | PANK4 antibody was raised using the N terminal of PANK4 corresponding to a region with amino acids MAECGASGSGSSGDSLDKSITLPPDEIFRNLENAKRFAIDIGGSLTKLAY |
Other Names | pantothenate kinase 4; Pantothenate kinase 4; pantothenate kinase 4; pantothenate kinase 4; Pantothenic acid kinase 4, PANK4; PANK4; hPanK4 |
Gene, Accession # | PANK4, Gene ID: 55229, NCBI: NP_060686.2 |
Catalog # | MBS839437 |
Price | |
Order / More Info | PANK4 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |