| Edit |   |
|---|
| Antigenic Specificity | PANK4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | PANK4 antibody. Specificity: PANK4 antibody was raised against the N terminal of PANK4 |
|---|
| Immunogen | PANK4 antibody was raised using the N terminal of PANK4 corresponding to a region with amino acids MAECGASGSGSSGDSLDKSITLPPDEIFRNLENAKRFAIDIGGSLTKLAY |
|---|
| Other Names | pantothenate kinase 4; Pantothenate kinase 4; pantothenate kinase 4; pantothenate kinase 4; Pantothenic acid kinase 4, PANK4; PANK4; hPanK4 |
|---|
| Gene, Accession # | PANK4, Gene ID: 55229, NCBI: NP_060686.2 |
|---|
| Catalog # | MBS839437 |
|---|
| Price | |
|---|
| Order / More Info | PANK4 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|