| 产品详情 |
| Edit |   |
| Antigenic Specificity | GTPase HRAS |
| Clone | n/a |
| Host Species | n/a |
| Reactive Species | mouse, rat predicted to work with: human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Anti-GTPase HRAS Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human GTPase HRAS (101-137aa KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLAR SY), identical to the related mouse and rat sequences.Ig Type: Rabbit IgG |
| Other Names | GTPase HRas isoform 1; GTPase HRas; GTPase HRas; Harvey rat sarcoma viral oncogene homolog; H-Ras-1; Ha-Ras; Transforming protein p21; c-H-ras; p21ras, HRAS; HRAS; CTLO; HAMSV; HRAS1; RASH1; p21ras; C-H-RAS; H-RASIDX; C-BAS/HAS; C-HA-RAS1; HRAS1 |
| Gene, Accession # | GTPase HRAS, Gene ID: 3265, NCBI: NP_001123914.1, UniProt: P01112 |
| Catalog # | MBS178394 |
| Price | |
| Order / More Info | GTPase HRAS Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: v-Ha-ras Harvey rat sarcoma viral oncogene homolog. 2. Russell MW, Munroe DJ, Bric E, Housman DE, Dietz-Band J, Riethman HC, Collins FS, Brody LC (July 1996). A 500-kb physical map and contig from the Harvey ras-1 gene to the 11p telomere. Genomics 35 (2): 353-60. 3. Wong-Staal F, Dalla-Favera R, Franchini G, Gelmann EP, Gallo RC (July 1981). Three distinct genes in human DNA related to the transforming genes of mammalian sarcoma retroviruses. Science 213 (4504): 226-8. |
| 产品资料 |
|
|