Edit |   |
Antigenic Specificity | GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, dog |
Isotype | n/a |
Format | purified |
Size | 100 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | G3BP is one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. |
Immunogen | G3 BP antibody was raised using the N terminal Of G3 p corresponding to a region with amino acids EVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEE |
Other Names | fj17h05|zgc:56034|wu:fj17h05|g3bp|MGC53271|G3BP1|G3BP|HDH-VIII|G3bp|RGD1310666|AI849976|B430204O07|C87777|mKIAA4115|AA409541|E430034L04Rik|mKIAA0660 |
Gene, Accession # | Gene ID: 10146,23881 |
Catalog # | ABIN630227 |
Price | |
Order / More Info | GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |