| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GTPase Activating Protein and VPS9 Domains 1 (GAPVD1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat, dog |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | GAPVD1 acts both as a GTPase-activating protein (GAP) and a guanine nucleotide exchange factor (GEF), and participates in various processes such as endocytosis, insulin receptor internalization or LC2A4/GLUT4 trafficking. It acts as a GEF for the Ras-related protein RAB31 by exchanging bound GDP for free GTP, leading to regulate LC2A4/GLUT4 trafficking. In the absence of insulin, it maintains RAB31 in an active state and promotes a futile cycle between LC2A4/GLUT4 storage vesicles and early endosomes, retaining LC2A4/GLUT4 inside the cells. Upon insulin stimulation, it is translocated to the plasma membrane, releasing LC2A4/GLUT4 from intracellular storage vesicles. It is also involved in EGFR trafficking and degradation, possibly by promoting EGFR ubiquitination and subsequent degradation by the proteasome. It has GEF activity for Rab5 and GAP activity for Ras. |
|---|
| Immunogen | GAPVD1 antibody was raised using the N terminal of GAPVD1 corresponding to a region with amino acids FKLFSEGLFSAKLFLTATLHEPIMQLLVEDEDHLETDPNKLIERFSPSQQ |
|---|
| Other Names | zgc:92666|GAPEX5|RAP6|2010005B09Rik|4432404J10Rik|AW108497|Gapex-5|RME-6|mKIAA1521|RGD1307479 |
|---|
| Gene, Accession # | Gene ID: 26130,480725,66691,311880 |
|---|
| Catalog # | ABIN630695 |
|---|
| Price | |
|---|
| Order / More Info | GTPase Activating Protein and VPS9 Domains 1 (GAPVD1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|